General Information

    • DRAMP ID

    • DRAMP03661

    • Peptide Name

    • Gallinacin-13 (Gal-13; Beta-defensin 13; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL13

    • Sequence

    • FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHSVLHTAEQDPSPSLGGT

    • Sequence Length

    • 66

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Salmonella typhimurium;
      • Gram-positive bacteria: Listeria monocytogenes, Streptococcus pyogenes.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03661 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03661.

Physicochemical Information

    • Formula

    • C312H482N104O94S8

    • Absent Amino Acids

    • IY

    • Common Amino Acids

    • S

    • Mass

    • 7450.38

    • PI

    • 8.96

    • Basic Residues

    • 13

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +9

    • Boman Index

    • -172.88

    • Hydrophobicity

    • -0.774

    • Aliphatic Index

    • 36.97

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 90.38

    • Polar Residues

    • 27

DRAMP03661

DRAMP03661 chydropathy plot

Comments Information

    • Tissue specificity

    • Expressed in the liver, gall bladder, kidney, small intestine, spleen, testis, ovary and male and female reproductive tracts. Not detected in the ovarian stroma and the theca and granulosa layers of the ovarian follicle. PTM

Literature Information

  • ·Literature 1

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.
  • ·Literature 2

    • Title

    • A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.

    • Reference

    • BMC Genomics. 2004 Aug 13;5(1):56.

    • Author

    • Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D, Zhang G.
  • ·Literature 3

    • Title

    • The synthetic form of a novel chicken beta-defensin identified in silico is predominantly active against intestinal pathogens.

    • Reference

    • Immunogenetics. 2005 Apr;57(1-2):90-98.

    • Author

    • Higgs R, Lynn DJ, Gaines S, McMahon J, Tierney J, James T, Lloyd AT, Mulcahy G, O'Farrelly C.