General Information

    • DRAMP ID

    • DRAMP03662

    • Peptide Name

    • Gallinacin-14 (Gal-14; Beta-defensin 14; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL14

    • Sequence

    • ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW

    • Sequence Length

    • 41

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03662 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03662.

Physicochemical Information

    • Formula

    • C206H321N57O55S7

    • Absent Amino Acids

    • HIQ

    • Common Amino Acids

    • C

    • Mass

    • 4700.58

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -68.42

    • Hydrophobicity

    • -0.242

    • Aliphatic Index

    • 38.05

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 184.13

    • Polar Residues

    • 18

DRAMP03662

DRAMP03662 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 7-36; 14-29; 19-37.

Literature Information

  • ·Literature 1

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.
  • ·Literature 2

    • Title

    • A novel chicken beta-defensin, gallinacin 14.

    • Reference

    • Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Soulier A.J, Rothwell L, Lovell M.A, Bumstead N, Barrow P.A, Kaiser P.