General Information

    • DRAMP ID

    • DRAMP03663

    • Peptide Name

    • cLEAP-2 (Chicken LEAP-2; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MTPFWRGVSLRPVGASCRDNSECITMLCRKNRCFLRTASE

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: S. enterica serovar Typhimurium strain SL1344, mutant S. enterica serovar Typhimurium strain phoP.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03663 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03663.

Physicochemical Information

    • Formula

    • C193H316N62O56S6

    • Absent Amino Acids

    • HQY

    • Common Amino Acids

    • R

    • Mass

    • 4593.37

    • PI

    • 9.37

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -100.63

    • Hydrophobicity

    • -0.283

    • Aliphatic Index

    • 58.5

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 147.44

    • Polar Residues

    • 15

DRAMP03663

DRAMP03663 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Induction of cationic chicken liver-expressed antimicrobial peptide 2 in response to Salmonella enterica infection.

    • Reference

    • Infect Immun. 2004 Dec;72(12):6987-6893.

    • Author

    • wnes CL, Michailidis G, Nile CJ, Hall J.