General Information

    • DRAMP ID

    • DRAMP03668

    • Peptide Name

    • Megourin-1 (arthropod; animals)

    • Source

    • Megoura viciae (Vetch aphid)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YLDVKQLANYLLCIGNGQVFNGRKTCQIGCRAVCQQPGCSGYKECEQIPNIRLHKYRCHCNEA

    • Sequence Length

    • 63

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03668 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03668.

Physicochemical Information

    • Formula

    • C305H486N94O89S8

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • C

    • Mass

    • 7150.27

    • PI

    • 8.7

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +6

    • Boman Index

    • -112.63

    • Hydrophobicity

    • -0.429

    • Aliphatic Index

    • 74.29

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6460

    • Absorbance 280nm

    • 104.19

    • Polar Residues

    • 25

DRAMP03668

DRAMP03668 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity against Gram-positive bacteria and fungi.

    • Induction

    • By bacterial infection.

    • PTM

    • Contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Unknown

    • Reference

    • Submitted (JUL-2002) to UniProtKB

    • Author

    • Bulet P, Charlet M, Chernish S, Hetru C.