• • DRAMP ID

  • DRAMP03671

• • Peptide Name

  • Locustin (Insects, animals)

• • Source

  • Locusta migratoria (Migratory locust)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • ATTGCSCPQCIIFDPICASSYKNGRRGFSSGCHMRCYNRCHGTDYFQISKGSKCI

• • Sequence Length

  • 55

• • UniProt Entry

  • P83428

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacterium: Micrococcus luteus.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03671.

DRAMP03671

• • Function

  • Has antibacterial activity.

• • Tissue specificity

  • Stored in hemocyte granules and secreted into the hemolymph.

• ·Literature 1

• • Title

  • Unknown

• • Pubmed ID

  • PubMed ID is not available

• • Reference

  • Submitted (JUL-2002) to UniProtKB

• • Author

  • Bulet P, Charlet M, Sabatier-Ehret L.