• • DRAMP ID

  • DRAMP03676

• • Peptide Name

  • GLFcin (Lactoferrin fragment)

• • Source

  • Capra hircus (Goat)

• • Family

  • Belongs to the transferrin family

• • Gene

  • LTF

• • Sequence

  • APRKNVRWCAISLPEWSKCYQWQRRMRKLGAPSITCIRRTS

• • Sequence Length

  • 41

• • UniProt Entry

  • Q29477,Q29479

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-negative bacteria: Escherichia coli (MIC=4.07 µg/ml), Propioni bacterium acnes (MIC=12.32 µg/ml), Pseudemonas aeruginosa (MIC=4.07 µg/ml);
    • Gram-positive bacteria: Bacillus cereus (MIC=12.32 µg/ml), Staphylococcus aureus (MIC=4.07 µg/ml), Listeria monocytogene (MIC=4.07 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP03676_predicted_structure.pdb to download.

DRAMP03676

• • Function

  • GLFcin is thermal-stable and with high antibacterial activity.

• ·Literature 1

• • Title

  • Expression of recombinant antibacterial lactoferricin-related peptides from Pichia pastoris expression system.

• • Pubmed ID

  • 19780544

• • Reference

  • J Agric Food Chem. 2009 Oct 28;57(20):9509-9515.

• • Author

  • Chen GH, Chen WM, Huang GT, Chen YW, Jiang ST.