General Information

    • DRAMP ID

    • DRAMP03691

    • Peptide Name

    • Im-1 (Arthropods, animals)

    • Source

    • Isometrus maculatus (Lesser brown scorpion)

    • Family

    • Belongs to the scorpion BPP family

    • Gene

    • Not found

    • Sequence

    • FSFKRLKGFAKKLWNSKLARKIRTKGLKYVKNFAKDMLSEGEEAPPAAEPPVEAPQ

    • Sequence Length

    • 56

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli NBRC 3972 (MIC=0.4-0.8 µM);
      • Gram-positive bacteria: Staphylococcus aureus NBRC 13276 (MIC=13-25 µM), Bacillus subtilis NBRC 3009 (MIC=0.8-1.6 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Linera

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03691 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03691.

Physicochemical Information

    • Formula

    • C292H467N79O77S

    • Absent Amino Acids

    • CH

    • Common Amino Acids

    • K

    • Mass

    • 6348.46

    • PI

    • 10.07

    • Basic Residues

    • 13

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +7

    • Boman Index

    • -105.07

    • Hydrophobicity

    • -0.73

    • Aliphatic Index

    • 64.64

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 127.09

    • Polar Residues

    • 10

DRAMP03691

DRAMP03691 chydropathy plot

Comments Information

    • Function

    • Causes cytolysis by the formation of pores in the membrane. Causes rapid and reversible paralysis in crickets. Has antibacterial activity.

    • Tissue specificity

    • Expressed by the venom gland.

    • Toxic dose

    • PD50 is 38 mg/kg into the insect A. domestica.

Literature Information

  • ·Literature 1

    • Title

    • A novel amphipathic linear peptide with both insect toxicity and antimicrobial activity from the venom of the scorpion Isometrus maculatus.

    • Reference

    • Biosci Biotechnol Biochem. 2010;74(2):364-369.

    • Author

    • Miyashita M, Sakai A, Matsushita N, Hanai Y, Nakagawa Y, Miyagawa H.