General Information

    • DRAMP ID

    • DRAMP03692

    • Peptide Name

    • Defensin-1 (Cll-dlp; Arthropods, animals)

    • Source

    • Centruroides limpidus limpidus (Mexican scorpion)

    • Family

    • Belongs to the invertebrate defensin family

    • Gene

    • Not found

    • Sequence

    • ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.15197474]Gram-positive bacteria: Bacillus subtilis (MIC>50 µg/ml), Staphylococcus aureus ATCC 25923 (MIC>50 µg/ml);
      • Gram-negative bacteria: Escherichia coli DH5a (MIC>50 µg/ml), Klebsiella pneumoniae ATCC 13883 (MIC>50 µg/ml).
      • NOTE: Liquid growth inhibition assay.

    • Hemolytic Activity

      • [Swiss_Prot Entry Q6GU94]Non-hemolytic activity against human erythrocytes

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03692 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03692.

Physicochemical Information

    • Formula

    • C165H235N47O47S6

    • Absent Amino Acids

    • DEHLMPTV

    • Common Amino Acids

    • C

    • Mass

    • 3821.33

    • PI

    • 8.65

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +3

    • Boman Index

    • -54.1

    • Hydrophobicity

    • -0.522

    • Aliphatic Index

    • 27.5

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 559.19

    • Polar Residues

    • 18

DRAMP03692

DRAMP03692 chydropathy plot

Comments Information

    • Function

    • Antibacterial protein involved in the immune response to septic injury. When combined with 14.026 kDa and 14.059 kDa hemolymph antimicrobial peptides, it has a strong cooperative activity against bacteria. No detectable antibacterial activity when present alone. Has no hemolytic activity against human erythrocytes.

    • Induction

    • By septic injury.

    • PTM

    • Contains three disulfide bonds 2-21; 7-29; 11-31.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptide induction in the haemolymph of the Mexican scorpion Centruroides limpidus limpidus in response to septic injury.

    • Reference

    • Cell Mol Life Sci. 2004 Jun;61(12):1507-1519.

    • Author

    • Rodríguez de la Vega RC, García BI, D'Ambrosio C, Diego-García E, Scaloni A, Possani LD.