General Information

    • DRAMP ID

    • DRAMP03695

    • Peptide Name

    • Probable antimicrobial peptide Con13 (Arthropods, animals)

    • Source

    • Opisthacanthus cayaporum (South American scorpion)

    • Family

    • Belongs to the antimicrobial peptide scorpion family

    • Gene

    • Not found

    • Sequence

    • GFWSKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATPS

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • [Swiss_Prot Entry C7C1L2]has hemolytic activity

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03695 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03695.

Physicochemical Information

    • Formula

    • C216H339N57O60

    • Absent Amino Acids

    • CHMQRY

    • Common Amino Acids

    • K

    • Mass

    • 4694.41

    • PI

    • 10

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +5

    • Boman Index

    • -56.08

    • Hydrophobicity

    • -0.479

    • Aliphatic Index

    • 68.37

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11000

    • Absorbance 280nm

    • 261.9

    • Polar Residues

    • 12

DRAMP03695

DRAMP03695 chydropathy plot

Comments Information

    • Function

    • Hemolytic and antibacterial and antifungal peptide (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of cDNA sequences encoding for new venom peptides of the Brazilian scorpion Opisthacanthus cayaporum.

    • Reference

    • Toxicon. 2009 Sep 1;54(3):252-261.

    • Author

    • Silva EC, Camargos TS, Maranhão AQ, Silva-Pereira I, Silva LP, Possani LD, Schwartz EF.