General Information

    • DRAMP ID

    • DRAMP03701

    • Peptide Name

    • Imcroporin (Arthropods, animals)

    • Source

    • Isometrus maculatus (Lesser brown scorpion)

    • Family

    • Belongs to the short cationic antimicrobial peptide family

    • Gene

    • Not found

    • Sequence

    • QLEARFEPKQRNFRKRELDFEKLFANMPDY

    • Sequence Length

    • 30

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • [Ref.19451300]Gram-positive bacteria: Micrococcus luteus(MIC=20μg/ml), Bacillus thuringiensis(MIC=50μg/ml), Staphylococcus aureus(MIC=20μg/ml), Bacillus subtilis(MIC=50μg/ml).

    • Hemolytic Activity

      • [Ref.19451300]5% hemolytic activity at 40 μg/mL, 20% hemolytic at 50 μg/mL, 70% hemolytic aactivity at 100 μg/mL against human red blood cells

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03701 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03701.

Physicochemical Information

    • Formula

    • C172H263N49O48S

    • Absent Amino Acids

    • CGHISTVW

    • Common Amino Acids

    • EFR

    • Mass

    • 3817.34

    • PI

    • 8.43

    • Basic Residues

    • 7

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +1

    • Boman Index

    • -112.86

    • Hydrophobicity

    • -1.37

    • Aliphatic Index

    • 45.67

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 51.38

    • Polar Residues

    • 3

DRAMP03701

DRAMP03701 chydropathy plot

Comments Information

    • Function

    • Has potent antibacterial activity against Gram-positive bacteria, but not Gram-negative bacteria. Shows a weak cytotoxicity effect against mammalian cell lines and hemolytic activity against human erythrocytes.

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • Imcroporin, a new cationic antimicrobial peptide from the venom of the scorpion Isometrus maculates.

    • Reference

    • Antimicrob Agents Chemother. 2009 Aug;53(8):3472-7.

    • Author

    • Zhao Z, Ma Y, Dai C, Zhao R, Li S, Wu Y, Cao Z, Li W.