General Information

    • DRAMP ID

    • DRAMP03710

    • Peptide Name

    • Potassium channel toxin MeuTXK-beta-2 (MeuTXKbeta2; Arthropods, animals)

    • Source

    • Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)

    • Family

    • Belongs to the long chain scorpion toxin family (Class 1 subfamily)

    • Gene

    • Not found

    • Sequence

    • GFREKHFQRFVKYAVPESTLRTVLQTVVHKVGKTQFGCSAYQGYCDDHCQDIEKKEGFCHGFKCKCGIPMGF

    • Sequence Length

    • 72

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • [Ref.20045493]Slight hemolytic activity against mouse erythrocytes

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03710 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03710.

Physicochemical Information

    • Formula

    • C368H558N102O101S7

    • Absent Amino Acids

    • NW

    • Common Amino Acids

    • GKF

    • Mass

    • 8251.52

    • PI

    • 8.82

    • Basic Residues

    • 15

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +8

    • Boman Index

    • -120.45

    • Hydrophobicity

    • -0.449

    • Aliphatic Index

    • 48.61

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 68.24

    • Polar Residues

    • 23

DRAMP03710

DRAMP03710 chydropathy plot

Comments Information

    • Function

    • Has a low affinity binding to potassium channels of rat brain synaptosomes. Displays weak antibacterial activity against Stenotrophomonas sp. Strongly inhibits the development of the Plasmodium berghei ookinetes. Displays slight hemolytic effect on mouse erythrocytes. Induces cytolysis on Xenopus oocytes at high concentrations. Is not toxic on mice and on the insect Tenebrio molitor.

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • MeuTXKbeta1, a scorpion venom-derived two-domain potassium channel toxin-like peptide with cytolytic activity.

    • Reference

    • Biochim Biophys Acta. 2010 Apr;1804(4):872-883.

    • Author

    • Zhu S, Gao B, Aumelas A, del Carmen Rodríguez M, Lanz-Mendoza H, Peigneur S, Diego-Garcia E, Martin-Eauclaire MF, Tytgat J, Possani LD.