• DRAMP ID

    • DRAMP03719
    • Peptide Name

    • Scorpion defensin (Arthropods, animals)
    • Source

    • Leiurus quinquestriatus
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03719 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03719.
    • Formula

    • C177H272N64O46S6
    • Absent Amino Acids

    • DEMVW
    • Common Amino Acids

    • CGR
    • Mass

    • 4224.87
    • PI

    • 9.69
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +9
    • Boman Index

    • -99.28
    • Hydrophobicity

    • -0.651
    • Aliphatic Index

    • 26.49
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 93.19
    • Polar Residues

    • 18

DRAMP03719

DRAMP03719 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Purification and characterization of a scorpion defensin, a 4kDa antibacterial peptide presenting structural similarities with insect defensins and scorpion toxins.
    • Reference

    • Biochem Biophys Res Commun. 1993 Jul 15;194(1):17-22.
    • Author

    • Cociancich S, et al Hoffmann J.