General Information

    • DRAMP ID

    • DRAMP03719

    • Peptide Name

    • Scorpion defensin (Arthropods, animals)

    • Source

    • Leiurus quinquestriatus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03719 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03719.

Physicochemical Information

    • Formula

    • C177H272N64O46S6

    • Absent Amino Acids

    • DEMVW

    • Common Amino Acids

    • CGR

    • Mass

    • 4224.87

    • PI

    • 9.69

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +9

    • Boman Index

    • -99.28

    • Hydrophobicity

    • -0.651

    • Aliphatic Index

    • 26.49

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 93.19

    • Polar Residues

    • 18

DRAMP03719

DRAMP03719 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of a scorpion defensin, a 4kDa antibacterial peptide presenting structural similarities with insect defensins and scorpion toxins.

    • Reference

    • Biochem Biophys Res Commun. 1993 Jul 15;194(1):17-22.

    • Author

    • Cociancich S, et al Hoffmann J.