General Information

    • DRAMP ID

    • DRAMP03723

    • Peptide Name

    • Pandinin-1 (Pin1; Arthropods, animals)

    • Source

    • Pandinus imperator (Emperor scorpion)

    • Family

    • Belongs to the Scorpion family

    • Gene

    • Not found

    • Sequence

    • GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Pseudomonas aeruginosa (MIC>20.8 µM), Escherichia coli (MIC=20.8 µM);
      • Gram-positive bacteria: Enterococcus faecalis (MIC=1.3 µM), Bacillus subtilis (MIC=5.2 µM), Staphylococcus epidermidis (MIC=5.2 µM), Staphylococcus aureus (MIC=2.6 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03723 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03723.

Physicochemical Information

    • Formula

    • C220H350N58O62

    • Absent Amino Acids

    • CFHMR

    • Common Amino Acids

    • K

    • Mass

    • 4799.55

    • PI

    • 9.78

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +4

    • Boman Index

    • -43

    • Hydrophobicity

    • -0.366

    • Aliphatic Index

    • 84.32

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17990

    • Absorbance 280nm

    • 418.37

    • Polar Residues

    • 12

DRAMP03723

DRAMP03723 chydropathy plot

Comments Information

    • MOA

    • Disrupts cell membranes through formation of pores.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of unique amphipathic antimicrobial peptides from venom of the scorpion Pandinus imperator.

    • Reference

    • Biochem J. 2001 Oct 1;359(Pt 1):35-45.

    • Author

    • Corzo G, Escoubas P, Villegas E, Barnham KJ, He W, Norton RS, Nakajima T.
  • ·Literature 2

    • Title

    • Induction of morphological changes in model lipid membranes and the mechanism of membrane disruption by a large scorpion-derived pore-forming peptide.

    • Reference

    • Biophys J. 2005 Dec;89(6):4067-4080.

    • Author

    • Nomura K, Ferrat G, Nakajima T, Darbon H, Iwashita T, Corzo G.