General Information

    • DRAMP ID

    • DRAMP03728

    • Peptide Name

    • Hg-scorpine-like 2 (Arthropods, animals)

    • Source

    • Hadrurus gertschi (Scorpion)

    • Family

    • Belongs to the long chain scorpion toxin family (Class 3 subfamily)

    • Gene

    • Not found

    • Sequence

    • GILREKYAHKAIDVLTPMIGVPVVSKIVNNAAKQLVHKIAKNQQLCMFNKDVAGWCEKSCQQSAHQKGYCHGTKCKCGIPLNYK

    • Sequence Length

    • 84

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Yeasts

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03728 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03728.

Physicochemical Information

    • Formula

    • C411H669N119O112S8

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • K

    • Mass

    • 9326.04

    • PI

    • 9.48

    • Basic Residues

    • 17

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 27

    • Net Charge

    • +13

    • Boman Index

    • -95.02

    • Hydrophobicity

    • -0.271

    • Aliphatic Index

    • 83.57

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 124.64

    • Polar Residues

    • 25

DRAMP03728

DRAMP03728 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity against yeasts and bacteria (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Transcriptome analysis of the venom gland of the Mexican scorpion Hadrurus gertschi (Arachnida: Scorpiones).

    • Reference

    • BMC Genomics. 2007 May 16;8:119.

    • Author

    • Schwartz EF, Diego-Garcia E, Rodríguez de la Vega RC, Possani LD.