General Information

    • DRAMP ID

    • DRAMP03730

    • Peptide Name

    • Opiscorpine-2 (Arthropods, animals)

    • Source

    • Opistophthalmus carinatus (African yellow leg scorpion)

    • Family

    • Belongs to the long chain scorpion toxin family (Class 3 subfamily)

    • Gene

    • Not found

    • Sequence

    • KWLNEKSIQNKIDEKIGKNFLGGMAKAVVHKLAKNEFMCMANMDPTGSCETHCQKASGEKGYCHGTKCKCGVPLSY

    • Sequence Length

    • 76

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Yeasts

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03730 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03730.

Physicochemical Information

    • Formula

    • C360H578N102O107S10

    • Absent Amino Acids

    • R

    • Common Amino Acids

    • K

    • Mass

    • 8367.77

    • PI

    • 8.96

    • Basic Residues

    • 15

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +8

    • Boman Index

    • -109.44

    • Hydrophobicity

    • -0.554

    • Aliphatic Index

    • 53.95

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 118.07

    • Polar Residues

    • 28

DRAMP03730

DRAMP03730 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity against yeasts and bacteria (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The scorpine family of defensins: gene structure, alternative polyadenylation and fold recognition.

    • Reference

    • Cell Mol Life Sci. 2004 Jul;61(14):1751-1763.

    • Author

    • Zhu S, Tytgat J.