• DRAMP ID

    • DRAMP03732
    • Peptide Name

    • Opiscorpine-4 (Arthropods, animals)
    • Source

    • Opistophthalmus carinatus (African yellow leg scorpion)
    • Family

    • Belongs to the long chain scorpion toxin family (Class 3 subfamily)
    • Gene

    • Not found
    • Sequence

    • KWLNEKSIQNKIDEKIGKNFLGGMAKAVVHKLAKNEFMCVANIDMTKSCDTHCQKASGEKGYCHGTKCKCGVPLSY
    • Sequence Length

    • 76
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • Yeasts
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03732 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03732.
    • Formula

    • C364H589N103O107S9
    • Absent Amino Acids

    • R
    • Common Amino Acids

    • K
    • Mass

    • 8408.85
    • PI

    • 9.1
    • Basic Residues

    • 16
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +9
    • Boman Index

    • -111.23
    • Hydrophobicity

    • -0.49
    • Aliphatic Index

    • 62.89
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 118.07
    • Polar Residues

    • 27

DRAMP03732

DRAMP03732 chydropathy plot
    • Function

    • Has antimicrobial activity against yeasts and bacteria (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • The scorpine family of defensins: gene structure, alternative polyadenylation and fold recognition.
    • Reference

    • Cell Mol Life Sci. 2004 Jul;61(14):1751-1763.
    • Author

    • Zhu S, Tytgat J.