General Information

    • DRAMP ID

    • DRAMP03736

    • Peptide Name

    • Opistoporin-2 (OP2; Non-disulfide-bridged peptide 3.6, NDBP-3.6; Arthropods, animals)

    • Source

    • Opistophthalmus carinatus (African yellow leg scorpion)

    • Family

    • Belongs to the antimicrobial peptide scorpion family

    • Gene

    • Not found

    • Sequence

    • GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

    • [Swiss_Prot Entry P83314]strong antibacterial activity against Gram-negative bacteria but is less active against Gram-positive bacteria. Also has antifungal activity.

    • Hemolytic Activity

      • [Swiss_Prot Entry P83314]Weak hemolytic activity against human erythrocytes

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03736 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03736.

Physicochemical Information

    • Formula

    • C223H355N59O63

    • Absent Amino Acids

    • CHMQRY

    • Common Amino Acids

    • K

    • Mass

    • 4870.63

    • PI

    • 9.78

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +4

    • Boman Index

    • -58.59

    • Hydrophobicity

    • -0.541

    • Aliphatic Index

    • 77.73

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16500

    • Absorbance 280nm

    • 383.72

    • Polar Residues

    • 12

DRAMP03736

DRAMP03736 chydropathy plot

Comments Information

    • Function

    • At high concentrations, acts as pore former in cellular membranes and causes the leakage of the cells. At submicromolar concentrations, degranulates granulocytes and has weak hemolytic activity against human red blood cells. Also strongly inhibits the production of superoxide anions. Has a strong antibacterial activity against Gram-negative bacteria but is less active against Gram-positive bacteria. Also has antifungal activity. (By similarity)

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial and antifungal properties of alpha-helical, cationic peptides in the venom of scorpions from southern Africa.

    • Reference

    • Eur J Biochem. 2002 Oct;269(19):4799-4810.

    • Author

    • Moerman L, Bosteels S, Noppe W, Willems J, Clynen E, Schoofs L, Thevissen K, Tytgat J, Van Eldere J, Van Der Walt J, Verdonck F.