• DRAMP ID

    • DRAMP03739
    • Peptide Name

    • Buthinin (Sahara scorpion; Arthropods, animals)
    • Source

    • Androctonus australis (Sahara scorpion)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SIVPIRCRSNRDCRRFCGFRGGRCTYARQCLCGY
    • Sequence Length

    • 34
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Micrococcus luteus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Has three disulfide bonds
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03739 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03739.
    • Formula

    • C164H266N60O44S6
    • Absent Amino Acids

    • EHKMW
    • Common Amino Acids

    • R
    • Mass

    • 3974.65
    • PI

    • 9.8
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +7
    • Boman Index

    • -111.9
    • Hydrophobicity

    • -0.447
    • Aliphatic Index

    • 45.88
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 101.67
    • Polar Residues

    • 16

DRAMP03739

DRAMP03739 chydropathy plot
    • Function

    • Active against both Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Characterization of novel cysteine-rich antimicrobial peptides from scorpion blood.
    • Reference

    • J Biol Chem. 1996 Nov 22;271(47):29537-29544.
    • Author

    • Ehret-Sabatier L, Loew D, Goyffon M, Fehlbaum P, Hoffmann JA, van Dorsselaer A, Bulet P.