General Information

    • DRAMP ID

    • DRAMP03740

    • Peptide Name

    • Androctonus defensin (4 kDa defensin; Arthropods, animals)

    • Source

    • Androctonus australis (Sahara scorpion)

    • Family

    • Belongs to the invertebrate defensin family (Type 2 subfamily)

    • Gene

    • Not found

    • Sequence

    • GFGCPFNQGACHRHCRSIRRRGGYCAGLFKQTCTCYR

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Micrococcus luteus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03740 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03740.

Physicochemical Information

    • Formula

    • C177H273N63O46S6

    • Absent Amino Acids

    • DEMVW

    • Common Amino Acids

    • CGR

    • Mass

    • 4211.87

    • PI

    • 9.69

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +9

    • Boman Index

    • -95.21

    • Hydrophobicity

    • -0.576

    • Aliphatic Index

    • 26.49

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 93.19

    • Polar Residues

    • 18

DRAMP03740

DRAMP03740 chydropathy plot

Comments Information

    • Function

    • Active against both Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of novel cysteine-rich antimicrobial peptides from scorpion blood.

    • Reference

    • J Biol Chem. 1996 Nov 22;271(47):29537-29544.

    • Author

    • Ehret-Sabatier L, Loew D, Goyffon M, Fehlbaum P, Hoffmann JA, van Dorsselaer A, Bulet P.