General Information

    • DRAMP ID

    • DRAMP03749

    • Peptide Name

    • Peptide BmKa2 (Acidic venom peptide Ka2; NDBP-6.2; Arthropods, animals)

    • Source

    • Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

    • Family

    • Not found

    • Gene

    • Ka2

    • Sequence

    • YPASMDNYDDALEELDNLDLDDYFDLEPADFVLLDMWANMLESSDFDDME

    • Sequence Length

    • 50

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03749 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03749.

Physicochemical Information

    • Formula

    • C258H366N54O96S4

    • Absent Amino Acids

    • CGHIKQRT

    • Common Amino Acids

    • D

    • Mass

    • 5888.29

    • PI

    • 2.82

    • Basic Residues

    • 0

    • Acidic Residues

    • 18

    • Hydrophobic Residues

    • 17

    • Net Charge

    • -18

    • Boman Index

    • -106.64

    • Hydrophobicity

    • -0.522

    • Aliphatic Index

    • 76.2

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 203.47

    • Polar Residues

    • 9

DRAMP03749

DRAMP03749 chydropathy plot

Comments Information

    • Function

    • Highly acidic peptide that may have antibacterial activity.

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • Identification and functional characterization of novel scorpion venom peptides with no disulfide bridge from Buthus martensii Karsch.

    • Reference

    • Peptides. 2004 Feb;25(2):143-150.

    • Author

    • Zeng XC, Wang SX, Zhu Y, Zhu SY, Li WX.
  • ·Literature 2

    • Title

    • Genomic organization of four novel nondisulfide-bridged peptides from scorpion Mesobuthus martensii Karsch: gaining ins

    • Reference

    • Peptides. 2005 Dec;26(12):2427-2433.

    • Author

    • Luo F, Zeng XC, Hahin R, Cao ZJ, Liu H, Li WX.