General Information

    • DRAMP ID

    • DRAMP03761

    • Peptide Name

    • Scorpine-like peptide Tco 41.46-2 (Arthropods, animals)

    • Source

    • Tityus costatus (Brazilian scorpion)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLREKHVQKLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNNHCQDIERKDGECHGFKCKCAKD

    • Sequence Length

    • 68

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03761 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03761.

Physicochemical Information

    • Formula

    • C333H537N101O96S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • K

    • Mass

    • 7683.91

    • PI

    • 8.82

    • Basic Residues

    • 16

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +8

    • Boman Index

    • -136.85

    • Hydrophobicity

    • -0.59

    • Aliphatic Index

    • 74.56

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 50.07

    • Polar Residues

    • 18

DRAMP03761

DRAMP03761 chydropathy plot

Comments Information

    • Function

    • Scorpine-like peptide Tco 41.46-2 may have anti-bacterial activity.(By similarity)

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The Brazilian scorpion Tityus costatus Karsch: genes, peptides and function.

    • Reference

    • Toxicon. 2005 Mar 1;45(3):273-283.

    • Author

    • Diego-García E, Batista CV, García-Gómez BI, Lucas S, Candido DM, Gómez-Lagunas F, Possani LD.