• DRAMP ID

    • DRAMP03761
    • Peptide Name

    • Scorpine-like peptide Tco 41.46-2 (Arthropods, animals)
    • Source

    • Tityus costatus (Brazilian scorpion)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GLREKHVQKLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNNHCQDIERKDGECHGFKCKCAKD
    • Sequence Length

    • 68
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03761 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03761.
    • Formula

    • C333H537N101O96S6
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • K
    • Mass

    • 7683.91
    • PI

    • 8.82
    • Basic Residues

    • 16
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +8
    • Boman Index

    • -136.85
    • Hydrophobicity

    • -0.59
    • Aliphatic Index

    • 74.56
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 50.07
    • Polar Residues

    • 18

DRAMP03761

DRAMP03761 chydropathy plot
    • Function

    • Scorpine-like peptide Tco 41.46-2 may have anti-bacterial activity.(By similarity)
    • Tissue specificity

    • Expressed by the venom gland.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • The Brazilian scorpion Tityus costatus Karsch: genes, peptides and function.
    • Reference

    • Toxicon. 2005 Mar 1;45(3):273-283.
    • Author

    • Diego-García E, Batista CV, García-Gómez BI, Lucas S, Candido DM, Gómez-Lagunas F, Possani LD.