General Information

    • DRAMP ID

    • DRAMP03766

    • Peptide Name

    • Heteroscorpine-1 (HS-1; defensins; Arthropods, animals)

    • Source

    • Heterometrus laoticus (Thai giant scorpion)

    • Family

    • Belongs to the long chain scorpion toxin family (Class 3 subfamily)

    • Gene

    • Not found

    • Sequence

    • GWINEEKIQKKIDEKIGNNILGGMAKAVVHKLAKGEFQCVANIDTMGNCETHCQKTSGEKGFCHGTKCKCGKPLSY

    • Sequence Length

    • 76

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Bacillus subtilis (5.2 mm);
      • Gram-negative bacteria: Klebsiella pneumoniae (10.57 mm), Pseudomonas aeruginosa (6.4 mm).
      • NOTE: Diameter of clear zone from disc diffusion assay. Total protein is 6.25 µmole.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03766 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03766.

Physicochemical Information

    • Formula

    • C357H579N103O108S8

    • Absent Amino Acids

    • R

    • Common Amino Acids

    • K

    • Mass

    • 8298.63

    • PI

    • 8.79

    • Basic Residues

    • 15

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +7

    • Boman Index

    • -112.21

    • Hydrophobicity

    • -0.553

    • Aliphatic Index

    • 62.89

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 98.2

    • Polar Residues

    • 28

DRAMP03766

DRAMP03766 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds (By similarity).

    • Toxic dose

    • PD50 is 80 ul to crickets (Gryllus sp).

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of Heteroscorpine-1 (HS-1) toxin from Heterometrus laoticus scorpion venom.

    • Reference

    • Toxicon. 2007 Jan;49(1):19-29.

    • Author

    • Uawonggul N, Thammasirirak S, Chaveerach A, Arkaravichien T, Bunyatratchata W, Ruangjirachuporn W, Jearranaiprepame P, Nakamura T, Matsuda M, Kobayashi M, Hattori S, Daduang S.