General Information

    • DRAMP ID

    • DRAMP03780

    • Peptide Name

    • Big defensin (AiBD)

    • Source

    • Argopecten irradians (Bay scallop) (Aequipecten irradians)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AIPIAYVGMAVAPQVFRWLVRAYGAAAVTAAGVTLRRVINRSRSNDNHSCYGNRGWCRSSCRSYEREYRGGNLGVCGSYKCCVT

    • Sequence Length

    • 84

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03780 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03780.

Physicochemical Information

    • Formula

    • C397H626N128O113S7

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • RA

    • Mass

    • 9224.55

    • PI

    • 9.81

    • Basic Residues

    • 13

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +10

    • Boman Index

    • -157.65

    • Hydrophobicity

    • -0.141

    • Aliphatic Index

    • 70.83

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 20315

    • Absorbance 280nm

    • 244.76

    • Polar Residues

    • 36

DRAMP03780

DRAMP03780 chydropathy plot

Comments Information

    • Function

    • Significantly inhibits the growth of Gram-negative and Gram-positive bacteria and fungi in vitro.

    • Tissue specificity

    • Expressed in hemocytes.

    • PTM

    • Contains three disulfide bonds 50-81; 57-76; 61-82.

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning, expression of a big defensin gene from bay scallop Argopecten irradians and the antimicrobial activity of its recombinant protein.

    • Reference

    • Mol Immunol. 2007 Jan;44(4):360-368.

    • Author

    • Zhao J, Song L, Li C, Ni D, Wu L, Zhu L, Wang H, Xu W.