General Information

    • DRAMP ID

    • DRAMP03781

    • Peptide Name

    • CECdir-CECret

    • Source

    • Unknown

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARGGRATAAVNAAQQAIGLGQITADRTHQGVREIKKGIKKLWG

    • Sequence Length

    • 81

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03781 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03781.

Physicochemical Information

    • Formula

    • C371H629N123O106S

    • Absent Amino Acids

    • CFPSY

    • Common Amino Acids

    • A

    • Mass

    • 8540.9

    • PI

    • 11.43

    • Basic Residues

    • 16

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 32

    • Net Charge

    • +12

    • Boman Index

    • -128.49

    • Hydrophobicity

    • -0.362

    • Aliphatic Index

    • 89.38

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11000

    • Absorbance 280nm

    • 137.5

    • Polar Residues

    • 20

DRAMP03781

DRAMP03781 chydropathy plot

Comments Information

    • CECdir-CECret displays an enhanced in vitro antimicrobial activity and action spectrum in comparison to the monomer Cecropin A.

Literature Information

  • ·Literature 1

    • Title

    • Characterization and functional recovery of a novel antimicrobial peptide (CECdir-CECret) from inclusion bodies after expression in Escherichia coli.

    • Reference

    • Peptides. 2008 Apr;29(4):512-519.

    • Author

    • Schmitt P, Mercado L, Díaz M, Guzmán F, Arenas G, Marshall SH.