• DRAMP ID

    • DRAMP03781
    • Peptide Name

    • CECdir-CECret
    • Source

    • Unknown
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARGGRATAAVNAAQQAIGLGQITADRTHQGVREIKKGIKKLWG
    • Sequence Length

    • 81
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03781 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03781.
    • Formula

    • C371H629N123O106S
    • Absent Amino Acids

    • CFPSY
    • Common Amino Acids

    • A
    • Mass

    • 8540.9
    • PI

    • 11.43
    • Basic Residues

    • 16
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 32
    • Net Charge

    • +12
    • Boman Index

    • -128.49
    • Hydrophobicity

    • -0.362
    • Aliphatic Index

    • 89.38
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 137.5
    • Polar Residues

    • 20

DRAMP03781

DRAMP03781 chydropathy plot
    • CECdir-CECret displays an enhanced in vitro antimicrobial activity and action spectrum in comparison to the monomer Cecropin A.

  • ·Literature 1
    • Title

    • Characterization and functional recovery of a novel antimicrobial peptide (CECdir-CECret) from inclusion bodies after expression in Escherichia coli.
    • Reference

    • Peptides. 2008 Apr;29(4):512-519.
    • Author

    • Schmitt P, Mercado L, Díaz M, Guzmán F, Arenas G, Marshall SH.