General Information

    • DRAMP ID

    • DRAMP03789

    • Peptide Name

    • ABF-1 (nematodes, animals)

    • Source

    • Caenorhabditis elegans

    • Family

    • Not found

    • Gene

    • abf-1

    • Sequence

    • EASCARMDVPVMQRIAQGLCTSSCTAQKCMTGICKKVDSHPTCFCGGCSNANDVSLDTLISQLPHN

    • Sequence Length

    • 66

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03789 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03789.

Physicochemical Information

    • Formula

    • C284H470N86O96S11

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • CS

    • Mass

    • 6978.03

    • PI

    • 6.92

    • Basic Residues

    • 7

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +2

    • Boman Index

    • -92.55

    • Hydrophobicity

    • -0.024

    • Aliphatic Index

    • 66.52

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 7.69

    • Polar Residues

    • 27

DRAMP03789

DRAMP03789 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • abf-1 and abf-2, ASABF-type antimicrobial peptide genes in Caenorhabditis elegans.

    • Reference

    • Biochem J. 2002 Jan 15;361(Pt 2):221-230.

    • Author

    • Kato Y, Aizawa T, Hoshino H, Kawano K, Nitta K, Zhang H.