• DRAMP ID

    • DRAMP03794
    • Peptide Name

    • Caenacin-4 (Gly-rich, Tyr-rich; CNC-4, nematode, invertebrate, animals)
    • Source

    • Caenorhabditis elegans
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • QWGYGPYGGYGGGYPGMYGGYGMRPYGMYGGYGMGMYRPGLLGMLIGK
    • Sequence Length

    • 48
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03794 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03794.
    • Formula

    • C236H329N57O60S6
    • Absent Amino Acids

    • ACDEFHNSTV
    • Common Amino Acids

    • G
    • Mass

    • 5116.91
    • PI

    • 9.35
    • Basic Residues

    • 3
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +3
    • Boman Index

    • 11.64
    • Hydrophobicity

    • -0.354
    • Aliphatic Index

    • 32.5
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 20400
    • Absorbance 280nm

    • 434.04
    • Polar Residues

    • 29

DRAMP03794

DRAMP03794 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.
    • Reference

    • Nat Immunol. 2004 May;5(5):488-494.
    • Author

    • Couillault C, Pujol N, Reboul J, Sabatier L, Guichou JF, Kohara Y, Ewbank JJ.