General Information

    • DRAMP ID

    • DRAMP03796

    • Peptide Name

    • T07C4.4 (SPP-1; saposin-like protein, SAPLIP; roundworm, nematoda, animals)

    • Source

    • Caenorhabditis elegans

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NPANPLNLKKHHGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLCWTMLLPLHHECEEELKKVKKELKKDIENKDSPDKACKDVDLC

    • Sequence Length

    • 88

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (CD)

    • Structure Description

    • The CD spectrum of recombinant DEL βgalSAP of T07C4.4 is found to have a minimum at 208 nm, a distinct shoulder at 222 nm and a maximum at about 193 nm, typical of alpha-helical proteins.

    • Helical Wheel Diagram

    • DRAMP03796 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03796.

Physicochemical Information

    • Formula

    • C432H694N116O135S7

    • Absent Amino Acids

    • QRY

    • Common Amino Acids

    • KL

    • Mass

    • 9897.38

    • PI

    • 5.09

    • Basic Residues

    • 17

    • Acidic Residues

    • 19

    • Hydrophobic Residues

    • 28

    • Net Charge

    • -2

    • Boman Index

    • -156.16

    • Hydrophobicity

    • -0.557

    • Aliphatic Index

    • 89.66

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11375

    • Absorbance 280nm

    • 130.75

    • Polar Residues

    • 19

DRAMP03796

DRAMP03796 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Amoebapore homologs of Caenorhabditis elegans.

    • Reference

    • Biochim Biophys Acta. 1998 Dec 8;1429(1):259-264.

    • Author

    • Bányai L, Patthy L.