• • DRAMP ID

  • DRAMP03797

• • Peptide Name

  • CAP7 (C-terminal fragment of CAP18; lagomorphs, mammals, animals)

• • Source

  • Oryctolagus cuniculus (Rabbit)

• • Family

  • Belongs to the cathelicidin family

• • Gene

  • CAP18

• • Sequence

  • GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY

• • Sequence Length

  • 37

• • UniProt Entry

  • P25230

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial

• • Target Organism

  • • [No NaCl]: Escherichia coli DH5a (MIC=0.19 µM), Escherichia coli ML-35p (MIC=0.05 µM), Pseudomonas aeruginosa PAO1 (MIC=0.2 µM), Pseudomonas aeruginosa MR3007 (MIC=0.05 µM), Staphylococcus aureus ATCC (MRSA) 33591 (MIC=1.24 µM), Staphylococcus aureus 93918 (MIC=0.41 µM).
    • [100 mM NaCl]: Escherichia coli DH5a (MIC=0.21 µM), Escherichia coli ML-35p (MIC=0.09 µM), Pseudomonas aeruginosa PAO1 (MIC=0.62 µM), Pseudomonas aeruginosa MR3007 (MIC=0.36 µM), Staphylococcus aureus ATCC (MRSA) 33591 (MIC=1.36 µM), Staphylococcus aureus 93918 (MIC=0.63 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Lipopolysaccharides (LPS)-binding

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Alpha helix (1 helices; 30 residues)

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 1LYP resolved by NMR.
• 1LYP-> 

• Predicted Structure

• There is no predicted structure for DRAMP03797.

DRAMP03797

• • Function

  • CAP18 binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Has antibiotic activity.

• • Tissue specificity

  • Neutrophils.

• • PTM

  • Contains two disulfide bonds (By similarity).

• ·Literature 1

• • Title

  • Antimicrobial activity of rabbit CAP18-derived peptides.

• • Pubmed ID

  • 8132348

• • Reference

  • Antimicrob Agents Chemother. 1993 Dec;37(12):2534-2539.

• • Author

  • Larrick JW, Hirata M, Shimomoura Y, Yoshida M, Zheng H, Zhong J, Wright SC.

• ·Literature 2

• • Title

  • Bactericidal activity of mammalian cathelicidin-derived peptides.

• • Pubmed ID

  • 10768969

• • Reference

  • Infect Immun. 2000 May;68(5):2748-2755.

• • Author

  • Travis SM, Anderson NN, Forsyth WR, Espiritu C, Conway BD, Greenberg EP, McCray PB Jr, Lehrer RI, Welsh MJ, Tack BF.

• ·Literature 3

• • Title

  • The solution structure of the active domain of CAP18--a lipopolysaccharide binding protein from rabbit leukocytes.

• • Pubmed ID

  • 7649303

• • Reference

  • FEBS Lett. 1995 Aug 14;370(1-2):46-52.

• • Author

  • Chen C, Brock R, Luh F, Chou PJ, Larrick JW, Huang RF, Huang TH.