General Information

    • DRAMP ID

    • DRAMP03797

    • Peptide Name

    • CAP7 (C-terminal fragment of CAP18; lagomorphs, mammals, animals)

    • Source

    • Oryctolagus cuniculus (Rabbit)

    • Family

    • Belongs to the cathelicidin family

    • Gene

    • CAP18

    • Sequence

    • GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

      • [No NaCl]: Escherichia coli DH5a (MIC=0.19 µM), Escherichia coli ML-35p (MIC=0.05 µM), Pseudomonas aeruginosa PAO1 (MIC=0.2 µM), Pseudomonas aeruginosa MR3007 (MIC=0.05 µM), Staphylococcus aureus ATCC (MRSA) 33591 (MIC=1.24 µM), Staphylococcus aureus 93918 (MIC=0.41 µM).
      • [100 mM NaCl]: Escherichia coli DH5a (MIC=0.21 µM), Escherichia coli ML-35p (MIC=0.09 µM), Pseudomonas aeruginosa PAO1 (MIC=0.62 µM), Pseudomonas aeruginosa MR3007 (MIC=0.36 µM), Staphylococcus aureus ATCC (MRSA) 33591 (MIC=1.36 µM), Staphylococcus aureus 93918 (MIC=0.63 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharides (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Alpha helix (1 helices; 30 residues)

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03797 helical wheel diagram

    • PDB ID

    • 1LYP resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP03797.

Physicochemical Information

    • Formula

    • C204H352N64O47

    • Absent Amino Acids

    • CHMSW

    • Common Amino Acids

    • K

    • Mass

    • 4453.44

    • PI

    • 11.54

    • Basic Residues

    • 14

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +12

    • Boman Index

    • -111.44

    • Hydrophobicity

    • -1.114

    • Aliphatic Index

    • 84.32

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 41.39

    • Polar Residues

    • 6

DRAMP03797

DRAMP03797 chydropathy plot

Comments Information

    • Function

    • CAP18 binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Has antibiotic activity.

    • Tissue specificity

    • Neutrophils.

    • PTM

    • Contains two disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial activity of rabbit CAP18-derived peptides.

    • Reference

    • Antimicrob Agents Chemother. 1993 Dec;37(12):2534-2539.

    • Author

    • Larrick JW, Hirata M, Shimomoura Y, Yoshida M, Zheng H, Zhong J, Wright SC.
  • ·Literature 2

    • Title

    • Bactericidal activity of mammalian cathelicidin-derived peptides.

    • Reference

    • Infect Immun. 2000 May;68(5):2748-2755.

    • Author

    • Travis SM, Anderson NN, Forsyth WR, Espiritu C, Conway BD, Greenberg EP, McCray PB Jr, Lehrer RI, Welsh MJ, Tack BF.
  • ·Literature 3

    • Title

    • The solution structure of the active domain of CAP18--a lipopolysaccharide binding protein from rabbit leukocytes.

    • Reference

    • FEBS Lett. 1995 Aug 14;370(1-2):46-52.

    • Author

    • Chen C, Brock R, Luh F, Chou PJ, Larrick JW, Huang RF, Huang TH.