General Information

    • DRAMP ID

    • DRAMP03803

    • Peptide Name

    • Corticostatin-2 (Antiadrenocorticotropin peptide II; Corticostatin II; lagomorphs, mammals, anima

    • Source

    • Oryctolagus cuniculus (Rabbit)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Not found

    • Sequence

    • GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03803 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03803.

Physicochemical Information

    • Formula

    • C172H289N61O42S6

    • Absent Amino Acids

    • AHMNTW

    • Common Amino Acids

    • R

    • Mass

    • 4075.93

    • PI

    • 9.99

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +8

    • Boman Index

    • -110.85

    • Hydrophobicity

    • -0.447

    • Aliphatic Index

    • 62.94

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 56.52

    • Polar Residues

    • 11

DRAMP03803

DRAMP03803 chydropathy plot

Comments Information

    • Function

    • Microbicidal activity and inhibits corticotropin (ACTH) stimulated corticosterone production.

    • PTM

    • Problely contains three disulfide bonds 3-32; 5-21; 11-31.

Literature Information

  • ·Literature 1

    • Title

    • Primary structures of six antimicrobial peptides of rabbit peritonealneutrophils.

    • Reference

    • J Biol Chem. 1985 Apr 25;260(8):4579-4584.

    • Author

    • Selsted ME, Brown DM, DeLange RJ, Harwig SS, Lehrer RI.
  • ·Literature 2

    • Title

    • Isolation and mode of action of rabbit corticostatic (antiadrenocorticotropin) peptides.

    • Reference

    • Endocrinology. 1992 Mar;130(3):1413-1423.

    • Author

    • Zhu Q, Solomon S.