General Information

    • DRAMP ID

    • DRAMP03814

    • Peptide Name

    • D16W (GGN4 analogue peptide with single substitution)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GILDTLKQFAKGVGKWLVKGAAQGVLSTVSCKLAKTC

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.12199716]Gram-positive bacteria: Micrococcus luteus (MIC=25 µg/ml), Bacillus subtilis (MIC=2.5 µg/ml);
      • Gram-negative bacteria: Klebsiella pneumoniae (MIC=10 µg/ml), Shigella dysentariae (MIC=10 µg/ml), Pseudomonas putida (MIC=100 µg/ml), Pseudomonas aeruginosa (MIC=50 µg/ml), Eshchericia coli (MIC=10 µg/ml), Salmonella typhimurium (MIC=50 µg/ml).

    • Hemolytic Activity

      • [Ref.12199716] 1.97% hemolytic activity at 10 µg/mL, 52.9% hemolytic activity at 100 µg/mL against human red blood cells.

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization(Cys31 and Cys37).

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03814 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03814.

Physicochemical Information

    • Formula

    • C172H292N46O47S2

    • Absent Amino Acids

    • EHMNPRY

    • Common Amino Acids

    • K

    • Mass

    • 3820.61

    • PI

    • 9.79

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +5

    • Boman Index

    • -2.12

    • Hydrophobicity

    • 0.4

    • Aliphatic Index

    • 105.41

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 156.25

    • Polar Residues

    • 12

DRAMP03814

DRAMP03814 chydropathy plot

Comments Information

    • Function

    • Single substitution of aspartic acid 16 by tryptophan (D16W) in the native GGN4. Has hemolytic activity as well as the antimicrobial activity.

Literature Information

  • ·Literature 1

    • Title

    • Effects of a tryptophanyl substitution on the structure and antimicrobial activity of C-terminally truncated gaegurin 4.

    • Reference

    • Eur J Biochem. 2002 Sep;269(17):4367-4374.

    • Author

    • Won HS, Park SH, Kim HE, Hyun B, Kim M, Lee BJ, Lee BJ.