• DRAMP ID

    • DRAMP03814
    • Peptide Name

    • D16W (GGN4 analogue peptide with single substitution)
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GILDTLKQFAKGVGKWLVKGAAQGVLSTVSCKLAKTC
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Synthetic
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.12199716]Gram-positive bacteria:
        Target OrganismActivity
        Micrococcus luteusMIC=25 µg/ml
        Bacillus subtilis (MIC=2.5 µg/ml);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Klebsiella pneumoniaeMIC=10 µg/ml
        Shigella dysentariaeMIC=10 µg/ml
        Pseudomonas putidaMIC=100 µg/ml
        Pseudomonas aeruginosaMIC=50 µg/ml
        Eshchericia coliMIC=10 µg/ml
        Salmonella typhimuriumMIC=50 µg/ml
    • Hemolytic Activity

      • [Ref.12199716] 1.97% hemolytic activity at 10 µg/mL, 52.9% hemolytic activity at 100 µg/mL against human red blood cells.
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization(Cys31 and Cys37).
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.
    • Stereochemistry

    • L
    • Structure

    • Alpha helix
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03814 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03814.
    • Formula

    • C172H292N46O47S2
    • Absent Amino Acids

    • EHMNPRY
    • Common Amino Acids

    • K
    • Mass

    • 3820.61
    • PI

    • 9.79
    • Basic Residues

    • 6
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +5
    • Boman Index

    • -2.12
    • Hydrophobicity

    • 0.4
    • Aliphatic Index

    • 105.41
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 156.25
    • Polar Residues

    • 12

DRAMP03814

DRAMP03814 chydropathy plot
    • Function

    • Single substitution of aspartic acid 16 by tryptophan (D16W) in the native GGN4. Has hemolytic activity as well as the antimicrobial activity.
  • ·Literature 1
    • Title

    • Effects of a tryptophanyl substitution on the structure and antimicrobial activity of C-terminally truncated gaegurin 4.
    • Reference

    • Eur J Biochem. 2002 Sep;269(17):4367-4374.
    • Author

    • Won HS, Park SH, Kim HE, Hyun B, Kim M, Lee BJ, Lee BJ.