General Information

    • DRAMP ID

    • DRAMP03841

    • Peptide Name

    • ETD140 (Mutant of ARD1; Heliomicin analogs)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Candida albicans IHEM 8060 (MIC50=3.125 µg/ml), Aspergillus fumigatus GASP4707 (MIC50=12.5 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03841 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03841.

Physicochemical Information

    • Formula

    • C202H307N63O62S6

    • Absent Amino Acids

    • DMPQ

    • Common Amino Acids

    • CGN

    • Mass

    • 4802.4

    • PI

    • 8.65

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -71.88

    • Hydrophobicity

    • -0.418

    • Aliphatic Index

    • 44.32

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 333.84

    • Polar Residues

    • 25

DRAMP03841

DRAMP03841 chydropathy plot

Comments Information

    • Function

    • Possess antifungal activity.

Literature Information

  • ·Literature 1

    • Title

    • Lead optimization of antifungal peptides with 3D NMR structures analysis.

    • Reference

    • Protein Sci. 2004 Mar;13(3):703-713.

    • Author

    • Landon C, Barbault F, Legrain M, Menin L, Guenneugues M, Schott V, Vovelle F, Dimarcq JL.