• DRAMP ID

    • DRAMP03843
    • Peptide Name

    • ETD152 (Mutant of ARD1; Heliomicin analogs)
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • DKLIGSCVWGAVNYTSRCNAECKRRGYKGGHCGSFANVNCWCET
    • Sequence Length

    • 44
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Synthetic
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Candida albicans IHEM 8060 (MIC50=3.125 µg/ml), Aspergillus fumigatus GASP4707 (MIC50=25 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03843 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03843.
    • Formula

    • C204H312N64O62S6
    • Absent Amino Acids

    • MPQ
    • Common Amino Acids

    • CG
    • Mass

    • 4845.47
    • PI

    • 8.65
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +4
    • Boman Index

    • -82.24
    • Hydrophobicity

    • -0.441
    • Aliphatic Index

    • 44.32
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14355
    • Absorbance 280nm

    • 333.84
    • Polar Residues

    • 23

DRAMP03843

DRAMP03843 chydropathy plot
    • Function

    • Possess antifungal activity.
  • ·Literature 1
    • Title

    • Lead optimization of antifungal peptides with 3D NMR structures analysis.
    • Reference

    • Protein Sci. 2004 Mar;13(3):703-713.
    • Author

    • Landon C, Barbault F, Legrain M, Menin L, Guenneugues M, Schott V, Vovelle F, Dimarcq JL.