General Information

    • DRAMP ID

    • DRAMP03931

    • Peptide Name

    • hPAB-beta (a hBD-2 variant; beta-defensins)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPN

    • Sequence Length

    • 39

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

      • Type strains: Staphylococcus aureus ATCC25923 (MIC=62.5 µg/ml), Staphylococcus aureus ATCC29215 (MIC=62.5 µg/ml), Escherichia coli ATCC29213 (MIC=125 µg/ml), Enterococcus feces ATCC29212 (MIC=250 µg/ml).
      • Clinical strains: Salmonella typhoid (MIC=62.5 µg/ml), Salmonella typhoid A (MIC=62.5 µg/ml), Shigella dysentery (MIC=62.5 µg/ml), Escherichia coli (MIC=62.5 µg/ml), Staphylococcus aureus (MIC=31.25 µg/ml), Staphylococcus epidermis (MIC=62.5 µg/ml), Enterobacter cloacae (MIC=62.5 µg/ml), Bacillus proteus curious (MIC=62.5 µg/ml), Acinetobacter lwoffii (MIC=62.5 µg/ml), Pseudomonas aeruginosa Pa6 (MIC=125 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03931 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03931.

Physicochemical Information

    • Formula

    • C182H300N54O49S6

    • Absent Amino Acids

    • EMW

    • Common Amino Acids

    • C

    • Mass

    • 4221.08

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -50.41

    • Hydrophobicity

    • -0.292

    • Aliphatic Index

    • 57.44

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 49.08

    • Polar Residues

    • 16

DRAMP03931

DRAMP03931 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Design and expression of peptide antibiotic hPAB-beta as tandem multimers in Escherichia coli.

    • Reference

    • Peptides. 2005 May;26(5):721-729.

    • Author

    • Rao X, Hu J, Li S, Jin X, Zhang C, Cong Y, Hu X, Tan Y, Huang J, Chen Z, Zhu J, Hu F.