General Information

    • DRAMP ID

    • DRAMP03951

    • Peptide Name

    • Rs-AFP2 variant (Mutation: G16M)

    • Source

    • Synthetic construct (Mutation of Rs-AFP2)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QKLCQRPSGTWSGVCMNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 51

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • SMF- (synthetic low ionic strength medium): Fusarium culmorum (IC50=2.2±0.3);
      • SMF+ (SMF + 1 mM CaCl2 and 50 mM KCl): Fusarium culmorum (IC50=5.0±0.9).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03951 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03951.

Physicochemical Information

    • Formula

    • C247H385N77O68S9

    • Absent Amino Acids

    • D

    • Common Amino Acids

    • C

    • Mass

    • 5809.79

    • PI

    • 9.08

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +8

    • Boman Index

    • -89.07

    • Hydrophobicity

    • -0.426

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 22

DRAMP03951

DRAMP03951 chydropathy plot

Comments Information

    • Compared to Rs-AFP2, the mutation Rs-AFP2(G16M) has increased antifungal potency.

Literature Information

  • ·Literature 1

    • Title

    • Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity.

    • Reference

    • J Biol Chem. 1997 Jan 10;272(2):1171-1179.

    • Author

    • De Samblanx GW, Goderis IJ, Thevissen K, Raemaekers R, Fant F, Borremans F, Acland DP, Osborn RW, Patel S, Broekaert WF.