• DRAMP ID

    • DRAMP03954
    • Peptide Name

    • Rat CGA7–57
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MTKGDTKVMKCVLEVISDSLSKPSPMPVSPECLETLQGDERILSVLRHQNL
    • Sequence Length

    • 51
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Synthetic
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Neurospora crassa (MIC=10 µg/ml), Alternaria brassicicola (MIC=20 µg/ml), Nectria haematococca (MIC=10 µg/ml), Fusarium culmorum (MIC=20 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03954 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03954.
    • Formula

    • C242H412N66O78S5
    • Absent Amino Acids

    • AFWY
    • Common Amino Acids

    • LS
    • Mass

    • 5654.63
    • PI

    • 5.62
    • Basic Residues

    • 7
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 14
    • Net Charge

    • 0
    • Boman Index

    • -79.96
    • Hydrophobicity

    • -0.188
    • Aliphatic Index

    • 97.25
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 2.5
    • Polar Residues

    • 14

DRAMP03954

DRAMP03954 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Antibacterial and antifungal activities of vasostatin-1, the N-terminal fragment of chromogranin A.
    • Reference

    • J Biol Chem. 2000 Apr 14;275(15):10745-10753.
    • Author

    • Lugardon K, Raffner R, Goumon Y, Corti A, Delmas A, Bulet P, Aunis D, Metz-Boutigue MH.