General Information

    • DRAMP ID

    • DRAMP03955

    • Peptide Name

    • Human recombinant Ser-Thr-Ala-CGA1-78 peptide (hrVS-1)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • STALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKK

    • Sequence Length

    • 81

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: Micrococcus luteus (MIC=30 µM), Bacillus megaterium (MIC=30 µM).
      • Fungi: Neurospora crassa (MIC=10 µM), Alternaria brassicicola (MIC=1 µM), Nectria haematococca (MIC=3 µM), Fusarium culmorum (MIC=5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03955 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03955.

Physicochemical Information

    • Formula

    • C390H655N113O124S5

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • L

    • Mass

    • 9071.47

    • PI

    • 6.69

    • Basic Residues

    • 13

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +2

    • Boman Index

    • -165.91

    • Hydrophobicity

    • -0.514

    • Aliphatic Index

    • 90.25

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.56

    • Polar Residues

    • 19

DRAMP03955

DRAMP03955 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial and antifungal activities of vasostatin-1, the N-terminal fragment of chromogranin A.

    • Reference

    • J Biol Chem. 2000 Apr 14;275(15):10745-10753.

    • Author

    • Lugardon K, Raffner R, Goumon Y, Corti A, Delmas A, Bulet P, Aunis D, Metz-Boutigue MH.