General Information

    • DRAMP ID

    • DRAMP04015

    • Peptide Name

    • LL-37V9 (LL-37 variants)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LLGDFFRKVKEKIGKEFKRIVQRIKDFLRNLVPRTES

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli DC2 (MIC=12 µM), Escherichia coli K12 (MIC=25 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04015 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04015.

Physicochemical Information

    • Formula

    • C207H344N60O52

    • Absent Amino Acids

    • ACHMWY

    • Common Amino Acids

    • K

    • Mass

    • 4505.38

    • PI

    • 10.61

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -103.56

    • Hydrophobicity

    • -0.589

    • Aliphatic Index

    • 97.3

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 5

DRAMP04015

DRAMP04015 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activiy against the Gram-negative bacterium E. coli.

Literature Information

  • ·Literature 1

    • Title

    • Structure, dynamics, and antimicrobial and immune modulatory activities of human LL-23 and its single-residue variants mutated on the basis of homologous primate cathelicidins.

    • Reference

    • Biochemistry. 2012 Jan 17;51(2):653-664.

    • Author

    • Wang G, Elliott M, Cogen AL, Ezell EL, Gallo RL, Hancock RE.