General Information

    • DRAMP ID

    • DRAMP04071

    • Peptide Name

    • LL-37 pentamide

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus 930918-3, S. aureuss 710A, S. aureuss ATCC (MRSA) 33591, Staphylococcus epidermidis ATCC 49741.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04071 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04071.

Physicochemical Information

    • Formula

    • C208H343N65O48

    • Absent Amino Acids

    • ACDEHMWY

    • Common Amino Acids

    • K

    • Mass

    • 4522.42

    • PI

    • 12.61

    • Basic Residues

    • 11

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +11

    • Boman Index

    • -104.97

    • Hydrophobicity

    • -0.751

    • Aliphatic Index

    • 78.92

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 8

DRAMP04071

DRAMP04071 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activiy against Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • RL-37, an alpha-helical antimicrobial peptide of the rhesus monkey.

    • Reference

    • Antimicrob Agents Chemother. 2001 Oct;45(10):2695-2702.

    • Author

    • Zhao C, Nguyen T, Boo LM, Hong T, Espiritu C, Orlov D, Wang W, Waring A, Lehrer RI.