General Information

    • DRAMP ID

    • DRAMP04072

    • Peptide Name

    • Hinnavin II/MSH hybrid (rhin/MSH)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKGSYSMEHFRWGKPV

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04072 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04072.

Physicochemical Information

    • Formula

    • C267H418N74O67S2

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • KG

    • Mass

    • 5800.83

    • PI

    • 10.09

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +8

    • Boman Index

    • -59.38

    • Hydrophobicity

    • -0.388

    • Aliphatic Index

    • 76.47

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 279.6

    • Polar Residues

    • 12

DRAMP04072

DRAMP04072 chydropathy plot

Comments Information

    • Function

    • rhin/MSH has a broader spectrum of activity than did the parental hinnavin II or MSH against fungi and Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Expression of recombinant hybrid peptide hinnavin II/alpha-melanocyte-stimulating hormone in Escherichia coli: purification and characterization.

    • Reference

    • J Microbiol. 2010 Feb;48(1):24-29.

    • Author

    • Bang SK, Kang CS, Han MD, Bang IS.