General Information

    • DRAMP ID

    • DRAMP04073

    • Peptide Name

    • TvD1 (Recombinant peptide; alpha-defensin)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCWCTKRC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04073 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04073.

Physicochemical Information

    • Formula

    • C224H351N73O72S8

    • Absent Amino Acids

    • IMQV

    • Common Amino Acids

    • C

    • Mass

    • 5475.18

    • PI

    • 8.2

    • Basic Residues

    • 11

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +4

    • Boman Index

    • -158.49

    • Hydrophobicity

    • -1.006

    • Aliphatic Index

    • 27.02

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 162.83

    • Polar Residues

    • 21

DRAMP04073

DRAMP04073 chydropathy plot

Comments Information

    • Function

    • The purified peptide also showed significant inhibition of root elongation in Arabidopsis seedlings, subsequently affecting the extension of growing root hairs indicating that it has the potential to disturb the plant growth and development.

Literature Information

  • ·Literature 1

    • Title

    • Prokaryotic expression of a constitutively expressed Tephrosia villosa defensin and its potent antifungal activity.

    • Reference

    • Appl Microbiol Biotechnol. 2008 Oct;80(6):1023-1032.

    • Author

    • Vijayan S, Guruprasad L, Kirti PB.