General Information

    • DRAMP ID

    • DRAMP04252

    • Peptide Name

    • Sushi peptide 1 (truncated fragment)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS

    • Sequence Length

    • 34

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04252 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04252.

Physicochemical Information

    • Formula

    • C164H263N47O44S5

    • Absent Amino Acids

    • DHTY

    • Common Amino Acids

    • S

    • Mass

    • 3757.48

    • PI

    • 9.5

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -38.73

    • Hydrophobicity

    • -0.103

    • Aliphatic Index

    • 60.29

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 170.45

    • Polar Residues

    • 12

DRAMP04252

DRAMP04252 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Definition of endotoxin binding sites in horseshoe crab factor C recombinant sushi proteins and neutralization of endotoxin by sushi peptides.

    • Reference

    • FASEB J. 2000 Sep;14(12):1801-1813.

    • Author

    • Tan NS, Ng ML, Yau YH, Chong PK, Ho B, Ding JL.