General Information

    • DRAMP ID

    • DRAMP04254

    • Peptide Name

    • Neuropeptide Y (NPY)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04254 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP04254.

Physicochemical Information

    • Formula

    • C189H284N54O58S

    • Absent Amino Acids

    • CFVW

    • Common Amino Acids

    • Y

    • Mass

    • 4272.72

    • PI

    • 6.76

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -108.35

    • Hydrophobicity

    • -1.194

    • Aliphatic Index

    • 54.44

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7450

    • Absorbance 280nm

    • 212.86

    • Polar Residues

    • 11

DRAMP04254

DRAMP04254 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Enhancement of antimicrobial activity of neuropeptide Y by N-terminal truncation.

    • Reference

    • Antimicrob Agents Chemother. 1998 Oct;42(10):2745-2746.

    • Author

    • Shimizu M, Shigeri Y, Tatsu Y, Yoshikawa S, Yumoto N.