• DRAMP ID

    • DRAMP04259
    • Peptide Name

    • LL
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • DKLIGSCVWGAVNYTSDCNGECLLRGYKGGYCSGFANVNCWCET
    • Sequence Length

    • 44
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Synthetic
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04259 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04259.
    • Formula

    • C204H303N55O65S6
    • Absent Amino Acids

    • HMPQ
    • Common Amino Acids

    • G
    • Mass

    • 4758.34
    • PI

    • 4.78
    • Basic Residues

    • 3
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 12
    • Net Charge

    • -1
    • Boman Index

    • -42.08
    • Hydrophobicity

    • -0.061
    • Aliphatic Index

    • 59.77
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 15845
    • Absorbance 280nm

    • 368.49
    • Polar Residues

    • 25

DRAMP04259

DRAMP04259 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Solution structures of the antigungal heliomicin and a selected variant whit both antibacterial and antifungal activities.
    • Reference

    • Biochemistry. 2001 Oct 9;40(40):11995-2003.
    • Author

    • Lamberty M, Caille A, Landon C, Tassin-Moindrot S, Hetru C, Bulet P, Vovelle F.