• DRAMP ID

    • DRAMP04267
    • Peptide Name

    • CPα2
    • Source

    • Synthetic construct
    • Family

    • Derived from the peptide CP26, CP29, CEME and CEMA
    • Gene

    • Not found
    • Sequence

    • KWKKFIKKIGIGAVLKVLTTGLPALKLTKK
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Synthetic
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Escherichia coli (MIC=2 μg/ml), Salmonella typhimurium (MIC=2 μg/ml), Pseudomonas aeruginosa K799 (MIC=4 μg/ml), Pseudomonas aeruginosa Z61 (MIC=4 μg/ml), Pseudomonas aeruginosa H744 (MIC=2 μg/ml), Pseudomonas aeruginosa H374 (MIC=4 μg/ml), Pseudomonas aeruginosa H547 (MIC=2 μg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04267 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04267.
    • Formula

    • C161H282N40O34
    • Absent Amino Acids

    • CDEHMNQRSY
    • Common Amino Acids

    • K
    • Mass

    • 3322.26
    • PI

    • 10.9
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +9
    • Boman Index

    • 1.53
    • Hydrophobicity

    • 0.213
    • Aliphatic Index

    • 130
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 189.66
    • Polar Residues

    • 6

DRAMP04267

DRAMP04267 chydropathy plot
    • Function

    • Antibacterial activity against Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Biological properties of structurally related alpha-helical cationic antimicrobial peptides.
    • Reference

    • Infect Immun. 1999 Apr;67(4):2005-2009.
    • Author

    • Scott MG, Yan H, Hancock RE.