General Information

    • DRAMP ID

    • DRAMP04396

    • Peptide Name

    • Antimicrobial peptide OGC1

    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AIGNILKTLGNLAQKILGKQPKMLKLWKWNWKSSDVEYHLAKC

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04396 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C230H371N61O57S2

    • Absent Amino Acids

    • FR

    • Common Amino Acids

    • K

    • Mass

    • 4966.97

    • PI

    • 9.92

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +7

    • Boman Index

    • -32.99

    • Hydrophobicity

    • -0.323

    • Aliphatic Index

    • 104.42

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17990

    • Absorbance 280nm

    • 428.33

    • Polar Residues

    • 11

DRAMP04396

DRAMP04396 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptide from skin of Odorrana grahami.

    • Reference

    • Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Ma Y, Lai R, Wu J, Li J.