General Information

    • DRAMP ID

    • DRAMP04398

    • Peptide Name

    • Antifungal protein (PAF)

    • Source

    • Penicillium chrysogenum (Penicillium notatum)

    • Family

    • Not found

    • Gene

    • paf

    • Sequence

    • AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD

    • Sequence Length

    • 55

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand (5 strands; 24 residues)

    • Structure Description

    • PAF comprises five beta-strands forming two orthogonally packed beta-sheets that share a common interface.

    • Helical Wheel Diagram

    • DRAMP04398 helical wheel diagram

    • PDB ID

    • 2KCN resolved by NMR.
  • 2KCN-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP04398.

Physicochemical Information

    • Formula

    • C263H421N75O89S6

    • Absent Amino Acids

    • HLMQRW

    • Common Amino Acids

    • K

    • Mass

    • 6250.05

    • PI

    • 8.93

    • Basic Residues

    • 13

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +5

    • Boman Index

    • -171.77

    • Hydrophobicity

    • -1.375

    • Aliphatic Index

    • 23.09

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 89.72

    • Polar Residues

    • 25

DRAMP04398

DRAMP04398 chydropathy plot

Comments Information

    • Function

    • It exhibits antifungal activity.

Literature Information

  • ·Literature 1

    • Title

    • Functional aspects of the solution structure and dynamics of PAF--a highly-stable antifungal protein from Penicillium chrysogenum.

    • Reference

    • FEBS J. 2009 May;276(10):2875-2890.

    • Author

    • Batta G, Barna T, Gáspári Z, Sándor S, Kövér KE, Binder U, Sarg B, Kaiserer L, Chhillar AK, Eigentler A, Leiter E, Hegedüs N, Pócsi I, Lindner H, Marx F.
  • ·Literature 2

    • Title

    • oning, structural organization and regulation of expression of the Penicillium chrysogenum paf gene encoding an abundantly secreted protein with antifungal activity.

    • Reference

    • Gene. 1995 Dec 29;167(1-2):167-171.

    • Author

    • Marx F, Haas H, Reindl M, Stöffler G, Lottspeich F, Redl B.