General Information

    • DRAMP ID

    • DRAMP04408

    • Peptide Name

    • Carcinin

    • Source

    • Carcinus maenas (Common shore crab) (Green crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLFPNKDCKYWCKDNLGLNYCCGQPGVTYPPFTKKHLGRCPAVRDTCTGVRTQLPTYCPHDGACQFRSKCCYDTCLKHHVCKTAEYPY

    • Sequence Length

    • 88

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04408 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04408.

Physicochemical Information

    • Formula

    • C439H663N123O123S12

    • Absent Amino Acids

    • IM

    • Common Amino Acids

    • C

    • Mass

    • 10016.56

    • PI

    • 8.74

    • Basic Residues

    • 16

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +10

    • Boman Index

    • -150.29

    • Hydrophobicity

    • -0.598

    • Aliphatic Index

    • 43.18

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16680

    • Absorbance 280nm

    • 191.72

    • Polar Residues

    • 38

DRAMP04408

DRAMP04408 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Gene characterisation, isoforms and recombinant expression of carcinin, an antibacterial protein from the shore crab, Carcinus maenas.

    • Reference

    • Mol Immunol. 2007 Feb;44(5):943-949.

    • Author

    • Brockton V, Hammond JA, Smith VJ.