General Information

    • DRAMP ID

    • DRAMP04410

    • Peptide Name

    • Lantibiotic cytolysin

    • Source

    • Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM9153 / C-125)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GDVHAQTTWPCATVGVSVALCPTTKCTSQC

    • Sequence Length

    • 30

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04410 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04410.

Physicochemical Information

    • Formula

    • C128H206N36O43S4

    • Absent Amino Acids

    • EFIMNRY

    • Common Amino Acids

    • T

    • Mass

    • 3065.5

    • PI

    • 6.71

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +1

    • Boman Index

    • -16.39

    • Hydrophobicity

    • 0.257

    • Aliphatic Index

    • 61.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 198.28

    • Polar Residues

    • 14

DRAMP04410

DRAMP04410 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Complete genome sequence of the alkaliphilic bacterium Bacillus halodurans and genomic sequence comparison with Bacillus subtilis.

    • Reference

    • Nucleic Acids Res. 2000 Nov 1;28(21):4317-4331.

    • Author

    • Takami H, Nakasone K, Takaki Y, Maeno G, Sasaki R, Masui N, Fuji F, Hirama C, Nakamura Y, Ogasawara N, Kuhara S, Horikoshi K.