General Information

    • DRAMP ID

    • DRAMP04411

    • Peptide Name

    • Defensin like protein 2 (Predicted)

    • Source

    • Bombyx mori (Silk moth)

    • Family

    • Not found

    • Gene

    • defensin2

    • Sequence

    • ALPCAKKSCDSWCRRLDYPGGECVTKWKCSCNWMQIDK

    • Sequence Length

    • 38

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04411 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04411.

Physicochemical Information

    • Formula

    • C189H294N54O54S7

    • Absent Amino Acids

    • FH

    • Common Amino Acids

    • C

    • Mass

    • 4411.16

    • PI

    • 8.64

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +3

    • Boman Index

    • -74.33

    • Hydrophobicity

    • -0.626

    • Aliphatic Index

    • 43.68

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18365

    • Absorbance 280nm

    • 496.35

    • Polar Residues

    • 14

DRAMP04411

DRAMP04411 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Gene expression of a novel defensin antimicrobial peptide in the silkworm, Bombyx mori.

    • Reference

    • Biosci Biotechnol Biochem. 2008 Sep;72(9):2353-2361.

    • Author

    • Kaneko Y, Tanaka H, Ishibashi J, Iwasaki T, Yamakawa M.