General Information

    • DRAMP ID

    • DRAMP04413

    • Peptide Name

    • Defensin-like protein (Predicted)

    • Source

    • Dermacentor variabilis (American dog tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ASGCKADACKSYCKSLGSGGGYCDQGTWCVCN

    • Sequence Length

    • 32

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04413 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04413.

Physicochemical Information

    • Formula

    • C130H200N38O46S6

    • Absent Amino Acids

    • EFHIMPR

    • Common Amino Acids

    • CG

    • Mass

    • 3223.6

    • PI

    • 7.8

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +1

    • Boman Index

    • -32.68

    • Hydrophobicity

    • -0.222

    • Aliphatic Index

    • 30.63

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 285.65

    • Polar Residues

    • 20

DRAMP04413

DRAMP04413 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • New tick defensin isoform and antimicrobial gene expression in response to Rickettsia montanensis challenge.

    • Reference

    • Infect Immun. 2007 Apr;75(4):1973-1983.

    • Author

    • Ceraul SM, Dreher-Lesnick SM, Gillespie JJ, Rahman MS, Azad AF.